Anti CD300A pAb (ATL-HPA010971)

Atlas Antibodies

Catalog No.:
ATL-HPA010971-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CD300a molecule
Gene Name: CD300A
Alternative Gene Name: CMRF-35-H9, CMRF35H, IGSF12, IRC1, IRC2, Irp60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034652: 31%, ENSRNOG00000057058: 41%
Entrez Gene ID: 11314
Uniprot ID: Q9UGN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Gene Sequence SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Gene ID - Mouse ENSMUSG00000034652
Gene ID - Rat ENSRNOG00000057058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD300A pAb (ATL-HPA010971)
Datasheet Anti CD300A pAb (ATL-HPA010971) Datasheet (External Link)
Vendor Page Anti CD300A pAb (ATL-HPA010971) at Atlas Antibodies

Documents & Links for Anti CD300A pAb (ATL-HPA010971)
Datasheet Anti CD300A pAb (ATL-HPA010971) Datasheet (External Link)
Vendor Page Anti CD300A pAb (ATL-HPA010971)