Anti CD300A pAb (ATL-HPA010971)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010971-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CD300A
Alternative Gene Name: CMRF-35-H9, CMRF35H, IGSF12, IRC1, IRC2, Irp60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034652: 31%, ENSRNOG00000057058: 41%
Entrez Gene ID: 11314
Uniprot ID: Q9UGN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK |
| Gene Sequence | SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK |
| Gene ID - Mouse | ENSMUSG00000034652 |
| Gene ID - Rat | ENSRNOG00000057058 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD300A pAb (ATL-HPA010971) | |
| Datasheet | Anti CD300A pAb (ATL-HPA010971) Datasheet (External Link) |
| Vendor Page | Anti CD300A pAb (ATL-HPA010971) at Atlas Antibodies |
| Documents & Links for Anti CD300A pAb (ATL-HPA010971) | |
| Datasheet | Anti CD300A pAb (ATL-HPA010971) Datasheet (External Link) |
| Vendor Page | Anti CD300A pAb (ATL-HPA010971) |