Anti CD2BP2 pAb (ATL-HPA041508 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041508-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CD2 (cytoplasmic tail) binding protein 2
Gene Name: CD2BP2
Alternative Gene Name: LIN1, PPP1R59, Snu40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042502: 91%, ENSRNOG00000017201: 89%
Entrez Gene ID: 10421
Uniprot ID: O95400
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLY
Gene Sequence LGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLY
Gene ID - Mouse ENSMUSG00000042502
Gene ID - Rat ENSRNOG00000017201
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD2BP2 pAb (ATL-HPA041508 w/enhanced validation)
Datasheet Anti CD2BP2 pAb (ATL-HPA041508 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD2BP2 pAb (ATL-HPA041508 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD2BP2 pAb (ATL-HPA041508 w/enhanced validation)
Datasheet Anti CD2BP2 pAb (ATL-HPA041508 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD2BP2 pAb (ATL-HPA041508 w/enhanced validation)