Anti CD276 pAb (ATL-HPA017139 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017139-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD276
Alternative Gene Name: B7-H3, B7H3, B7RP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035914: 89%, ENSRNOG00000033608: 89%
Entrez Gene ID: 80381
Uniprot ID: Q5ZPR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG |
Gene Sequence | EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG |
Gene ID - Mouse | ENSMUSG00000035914 |
Gene ID - Rat | ENSRNOG00000033608 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) | |
Datasheet | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) | |
Datasheet | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) |
Citations for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) – 2 Found |
Zhang, Chaoqi; Zhang, Zhen; Li, Feng; Shen, Zhibo; Qiao, Yamin; Li, Lifeng; Liu, Shasha; Song, Mengjia; Zhao, Xuan; Ren, Feifei; He, Qianyi; Yang, Bo; Fan, Ruitai; Zhang, Yi. Large-scale analysis reveals the specific clinical and immune features of B7-H3 in glioma. Oncoimmunology. 7(11):e1461304. PubMed |
Lemke, Dieter; Pfenning, Philipp-Niclas; Sahm, Felix; Klein, Ann-Catherine; Kempf, Tore; Warnken, Uwe; Schnölzer, Martina; Tudoran, Ruxandra; Weller, Michael; Platten, Michael; Wick, Wolfgang. Costimulatory protein 4IgB7H3 drives the malignant phenotype of glioblastoma by mediating immune escape and invasiveness. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2012;18(1):105-17. PubMed |