Anti CD276 pAb (ATL-HPA017139 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017139-25

• 
• 
• 

Protein Description: CD276 molecule
Gene Name: CD276
Alternative Gene Name: B7-H3, B7H3, B7RP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035914: 89%, ENSRNOG00000033608: 89%
Entrez Gene ID: 80381
Uniprot ID: Q5ZPR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG
• Gene Sequence: EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG
• Gene ID - Mouse: ENSMUSG00000035914
• Gene ID - Rat: ENSRNOG00000033608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD276 pAb (ATL-HPA017139 w/enhanced validation) – 2 Found

Zhang, Chaoqi; Zhang, Zhen; Li, Feng; Shen, Zhibo; Qiao, Yamin; Li, Lifeng; Liu, Shasha; Song, Mengjia; Zhao, Xuan; Ren, Feifei; He, Qianyi; Yang, Bo; Fan, Ruitai; Zhang, Yi. Large-scale analysis reveals the specific clinical and immune features of B7-H3 in glioma. Oncoimmunology. 7(11):e1461304. 

Lemke, Dieter; Pfenning, Philipp-Niclas; Sahm, Felix; Klein, Ann-Catherine; Kempf, Tore; Warnken, Uwe; Schnölzer, Martina; Tudoran, Ruxandra; Weller, Michael; Platten, Michael; Wick, Wolfgang. Costimulatory protein 4IgB7H3 drives the malignant phenotype of glioblastoma by mediating immune escape and invasiveness. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2012;18(1):105-17.