Anti CD276 pAb (ATL-HPA009285 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA009285-25

Protein Description: CD276 molecule
Gene Name: CD276
Alternative Gene Name: B7-H3, B7H3, B7RP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035914: 95%, ENSRNOG00000033608: 95%
Entrez Gene ID: 80381
Uniprot ID: Q5ZPR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
• Gene Sequence: YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
• Gene ID - Mouse: ENSMUSG00000035914
• Gene ID - Rat: ENSRNOG00000033608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD276 pAb (ATL-HPA009285 w/enhanced validation) – 1 Found

Chen, Liuxi; Huang, Xingxing; Zhang, Wenzheng; Liu, Ying; Chen, Bi; Xiang, Yu; Zhang, Ruonan; Zhang, Mingming; Feng, Jiao; Liu, Shuiping; Duan, Ting; Chen, Xiaying; Wang, Wengang; Pan, Ting; Yan, Lili; Jin, Ting; Li, Guohua; Li, Yongqiang; Xie, Tian; Sui, Xinbing. Correlation of PD-L1 and SOCS3 Co-expression with the Prognosis of Hepatocellular Carcinoma Patients. Journal Of Cancer. 11(18):5440-5448.