Anti CD276 pAb (ATL-HPA009285 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA009285-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: CD276 molecule
Gene Name: CD276
Alternative Gene Name: B7-H3, B7H3, B7RP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035914: 95%, ENSRNOG00000033608: 95%
Entrez Gene ID: 80381
Uniprot ID: Q5ZPR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Gene Sequence YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Gene ID - Mouse ENSMUSG00000035914
Gene ID - Rat ENSRNOG00000033608
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD276 pAb (ATL-HPA009285 w/enhanced validation)
Datasheet Anti CD276 pAb (ATL-HPA009285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD276 pAb (ATL-HPA009285 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD276 pAb (ATL-HPA009285 w/enhanced validation)
Datasheet Anti CD276 pAb (ATL-HPA009285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD276 pAb (ATL-HPA009285 w/enhanced validation)
Citations for Anti CD276 pAb (ATL-HPA009285 w/enhanced validation) – 1 Found
Chen, Liuxi; Huang, Xingxing; Zhang, Wenzheng; Liu, Ying; Chen, Bi; Xiang, Yu; Zhang, Ruonan; Zhang, Mingming; Feng, Jiao; Liu, Shuiping; Duan, Ting; Chen, Xiaying; Wang, Wengang; Pan, Ting; Yan, Lili; Jin, Ting; Li, Guohua; Li, Yongqiang; Xie, Tian; Sui, Xinbing. Correlation of PD-L1 and SOCS3 Co-expression with the Prognosis of Hepatocellular Carcinoma Patients. Journal Of Cancer. 11(18):5440-5448.  PubMed