Anti CD27 pAb (ATL-HPA038936 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038936-25

• 
• 

Protein Description: CD27 molecule
Gene Name: CD27
Alternative Gene Name: S152, TNFRSF7, Tp55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030336: 68%, ENSRNOG00000027466: 66%
Entrez Gene ID: 939
Uniprot ID: P26842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR
• Gene Sequence: HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR
• Gene ID - Mouse: ENSMUSG00000030336
• Gene ID - Rat: ENSRNOG00000027466
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) – 2 Found

Kashima, Jumpei; Hishima, Tsunekazu; Okuma, Yusuke; Horio, Hirotoshi; Ogawa, Masumi; Hayashi, Yukiko; Horiguchi, Shin-Ichiro; Motoi, Toru; Ushiku, Tetsuo; Fukayama, Masashi. CD70 in Thymic Squamous Cell Carcinoma: Potential Diagnostic Markers and Immunotherapeutic Targets. Frontiers In Oncology. 11( 35145909):808396. 

Bell, Luisa; Lenhart, Alexander; Rosenwald, Andreas; Monoranu, Camelia M; Berberich-Siebelt, Friederike. Lymphoid Aggregates in the CNS of Progressive Multiple Sclerosis Patients Lack Regulatory T Cells. Frontiers In Immunology. 10( 32010141):3090.