Anti CD27 pAb (ATL-HPA038936 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038936-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD27
Alternative Gene Name: S152, TNFRSF7, Tp55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030336: 68%, ENSRNOG00000027466: 66%
Entrez Gene ID: 939
Uniprot ID: P26842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
Gene Sequence | HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
Gene ID - Mouse | ENSMUSG00000030336 |
Gene ID - Rat | ENSRNOG00000027466 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) | |
Datasheet | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) | |
Datasheet | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) |
Citations for Anti CD27 pAb (ATL-HPA038936 w/enhanced validation) – 2 Found |
Kashima, Jumpei; Hishima, Tsunekazu; Okuma, Yusuke; Horio, Hirotoshi; Ogawa, Masumi; Hayashi, Yukiko; Horiguchi, Shin-Ichiro; Motoi, Toru; Ushiku, Tetsuo; Fukayama, Masashi. CD70 in Thymic Squamous Cell Carcinoma: Potential Diagnostic Markers and Immunotherapeutic Targets. Frontiers In Oncology. 11( 35145909):808396. PubMed |
Bell, Luisa; Lenhart, Alexander; Rosenwald, Andreas; Monoranu, Camelia M; Berberich-Siebelt, Friederike. Lymphoid Aggregates in the CNS of Progressive Multiple Sclerosis Patients Lack Regulatory T Cells. Frontiers In Immunology. 10( 32010141):3090. PubMed |