Anti CD247 pAb (ATL-HPA008750 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008750-25

• 
• 

Protein Description: CD247 molecule
Gene Name: CD247
Alternative Gene Name: CD3H, CD3Q, CD3Z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005763: 83%, ENSRNOG00000003298: 89%
Entrez Gene ID: 919
Uniprot ID: P20963
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP
• Gene Sequence: KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP
• Gene ID - Mouse: ENSMUSG00000005763
• Gene ID - Rat: ENSRNOG00000003298
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) – 2 Found

Ang, Wei Xia; Li, Zhendong; Chi, Zhixia; Du, Shou-Hui; Chen, Can; Tay, Johan C K; Toh, Han Chong; Connolly, John E; Xu, Xue Hu; Wang, Shu. Intraperitoneal immunotherapy with T cells stably and transiently expressing anti-EpCAM CAR in xenograft models of peritoneal carcinomatosis. Oncotarget. 2017;8(8):13545-13559. 

Grundy, Seamus; Plumb, Jonathan; Lea, Simon; Kaur, Manminder; Ray, David; Singh, Dave. Down regulation of T cell receptor expression in COPD pulmonary CD8 cells. Plos One. 8(8):e71629.