Anti CD247 pAb (ATL-HPA008750 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008750-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD247
Alternative Gene Name: CD3H, CD3Q, CD3Z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005763: 83%, ENSRNOG00000003298: 89%
Entrez Gene ID: 919
Uniprot ID: P20963
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP |
Gene Sequence | KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP |
Gene ID - Mouse | ENSMUSG00000005763 |
Gene ID - Rat | ENSRNOG00000003298 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) | |
Datasheet | Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) | |
Datasheet | Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) |
Citations for Anti CD247 pAb (ATL-HPA008750 w/enhanced validation) – 2 Found |
Ang, Wei Xia; Li, Zhendong; Chi, Zhixia; Du, Shou-Hui; Chen, Can; Tay, Johan C K; Toh, Han Chong; Connolly, John E; Xu, Xue Hu; Wang, Shu. Intraperitoneal immunotherapy with T cells stably and transiently expressing anti-EpCAM CAR in xenograft models of peritoneal carcinomatosis. Oncotarget. 2017;8(8):13545-13559. PubMed |
Grundy, Seamus; Plumb, Jonathan; Lea, Simon; Kaur, Manminder; Ray, David; Singh, Dave. Down regulation of T cell receptor expression in COPD pulmonary CD8 cells. Plos One. 8(8):e71629. PubMed |