Anti CD24 pAb (ATL-HPA045879)

Atlas Antibodies

Catalog No.:
ATL-HPA045879-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD24 molecule
Gene Name: CD24
Alternative Gene Name: CD24A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047139: 49%, ENSRNOG00000000321: 45%
Entrez Gene ID: 100133941
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS
Gene Sequence TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS
Gene ID - Mouse ENSMUSG00000047139
Gene ID - Rat ENSRNOG00000000321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD24 pAb (ATL-HPA045879)
Datasheet Anti CD24 pAb (ATL-HPA045879) Datasheet (External Link)
Vendor Page Anti CD24 pAb (ATL-HPA045879) at Atlas Antibodies

Documents & Links for Anti CD24 pAb (ATL-HPA045879)
Datasheet Anti CD24 pAb (ATL-HPA045879) Datasheet (External Link)
Vendor Page Anti CD24 pAb (ATL-HPA045879)