Anti CD226 pAb (ATL-HPA015865)

Atlas Antibodies

SKU:
ATL-HPA015865-100
  • Immunofluorescent staining of human cell line HEL shows localization to plasma membrane & centriolar satellites.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: CD226 molecule
Gene Name: CD226
Alternative Gene Name: DNAM-1, DNAM1, PTA1, TLiSA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034028: 54%, ENSRNOG00000038197: 49%
Entrez Gene ID: 10666
Uniprot ID: Q15762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA
Gene Sequence EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA
Gene ID - Mouse ENSMUSG00000034028
Gene ID - Rat ENSRNOG00000038197
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD226 pAb (ATL-HPA015865)
Datasheet Anti CD226 pAb (ATL-HPA015865) Datasheet (External Link)
Vendor Page Anti CD226 pAb (ATL-HPA015865) at Atlas Antibodies

Documents & Links for Anti CD226 pAb (ATL-HPA015865)
Datasheet Anti CD226 pAb (ATL-HPA015865) Datasheet (External Link)
Vendor Page Anti CD226 pAb (ATL-HPA015865)