Anti CD207 pAb (ATL-HPA011216 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA011216-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CD207 molecule, langerin
Gene Name: CD207
Alternative Gene Name: CLEC4K, Langerin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034783: 61%, ENSRNOG00000013222: 57%
Entrez Gene ID: 50489
Uniprot ID: Q9UJ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Gene Sequence VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Gene ID - Mouse ENSMUSG00000034783
Gene ID - Rat ENSRNOG00000013222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD207 pAb (ATL-HPA011216 w/enhanced validation)
Datasheet Anti CD207 pAb (ATL-HPA011216 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD207 pAb (ATL-HPA011216 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD207 pAb (ATL-HPA011216 w/enhanced validation)
Datasheet Anti CD207 pAb (ATL-HPA011216 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD207 pAb (ATL-HPA011216 w/enhanced validation)
Citations for Anti CD207 pAb (ATL-HPA011216 w/enhanced validation) – 2 Found
Béziat, Vivien; Rapaport, Franck; Hu, Jiafen; Titeux, Matthias; Bonnet des Claustres, Mathilde; Bourgey, Mathieu; Griffin, Heather; Bandet, Élise; Ma, Cindy S; Sherkat, Roya; Rokni-Zadeh, Hassan; Louis, David M; Changi-Ashtiani, Majid; Delmonte, Ottavia M; Fukushima, Toshiaki; Habib, Tanwir; Guennoun, Andrea; Khan, Taushif; Bender, Noemi; Rahman, Mahbuba; About, Frédégonde; Yang, Rui; Rao, Geetha; Rouzaud, Claire; Li, Jingwei; Shearer, Debra; Balogh, Karla; Al Ali, Fatima; Ata, Manar; Dabiri, Soroosh; Momenilandi, Mana; Nammour, Justine; Alyanakian, Marie-Alexandra; Leruez-Ville, Marianne; Guenat, David; Materna, Marie; Marcot, Léa; Vladikine, Natasha; Soret, Christine; Vahidnezhad, Hassan; Youssefian, Leila; Saeidian, Amir Hossein; Uitto, Jouni; Catherinot, Émilie; Navabi, Shadi Sadat; Zarhrate, Mohammed; Woodley, David T; Jeljeli, Mohamed; Abraham, Thomas; Belkaya, Serkan; Lorenzo, Lazaro; Rosain, Jérémie; Bayat, Mousa; Lanternier, Fanny; Lortholary, Olivier; Zakavi, Faramarz; Gros, Philippe; Orth, Gérard; Abel, Laurent; Prétet, Jean-Luc; Fraitag, Sylvie; Jouanguy, Emmanuelle; Davis, Mark M; Tangye, Stuart G; Notarangelo, Luigi D; Marr, Nico; Waterboer, Tim; Langlais, David; Doorbar, John; Hovnanian, Alain; Christensen, Neil; Bossuyt, Xavier; Shahrooei, Mohammad; Casanova, Jean-Laurent. Humans with inherited T cell CD28 deficiency are susceptible to skin papillomaviruses but are otherwise healthy. Cell. 2021;184(14):3812-3828.e30.  PubMed
Cichoń, Małgorzata Anna; Pfisterer, Karin; Leitner, Judith; Wagner, Lena; Staud, Clement; Steinberger, Peter; Elbe-Bürger, Adelheid. Interoperability of RTN1A in dendrite dynamics and immune functions in human Langerhans cells. Elife. 2022;11( 36223176)  PubMed