Anti CD1E pAb (ATL-HPA057769)

Atlas Antibodies

SKU:
ATL-HPA057769-100
  • Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in subset of non-germinal center cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: CD1e molecule
Gene Name: CD1E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 42%, ENSRNOG00000016451: 41%
Entrez Gene ID: 913
Uniprot ID: P15812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWSHGNFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDF
Gene Sequence PWSHGNFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDF
Gene ID - Mouse ENSMUSG00000028076
Gene ID - Rat ENSRNOG00000016451
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD1E pAb (ATL-HPA057769)
Datasheet Anti CD1E pAb (ATL-HPA057769) Datasheet (External Link)
Vendor Page Anti CD1E pAb (ATL-HPA057769) at Atlas Antibodies

Documents & Links for Anti CD1E pAb (ATL-HPA057769)
Datasheet Anti CD1E pAb (ATL-HPA057769) Datasheet (External Link)
Vendor Page Anti CD1E pAb (ATL-HPA057769)