Anti CD1D pAb (ATL-HPA072662)

Atlas Antibodies

Catalog No.:
ATL-HPA072662-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD1d molecule
Gene Name: CD1D
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 60%, ENSRNOG00000016451: 62%
Entrez Gene ID: 912
Uniprot ID: P15813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW
Gene Sequence AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW
Gene ID - Mouse ENSMUSG00000028076
Gene ID - Rat ENSRNOG00000016451
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD1D pAb (ATL-HPA072662)
Datasheet Anti CD1D pAb (ATL-HPA072662) Datasheet (External Link)
Vendor Page Anti CD1D pAb (ATL-HPA072662) at Atlas Antibodies

Documents & Links for Anti CD1D pAb (ATL-HPA072662)
Datasheet Anti CD1D pAb (ATL-HPA072662) Datasheet (External Link)
Vendor Page Anti CD1D pAb (ATL-HPA072662)