Anti CD1A pAb (ATL-HPA010734 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010734-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CD1A
Alternative Gene Name: CD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 37%, ENSRNOG00000016451: 35%
Entrez Gene ID: 909
Uniprot ID: P06126
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND |
| Gene Sequence | QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND |
| Gene ID - Mouse | ENSMUSG00000028076 |
| Gene ID - Rat | ENSRNOG00000016451 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) | |
| Datasheet | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) | |
| Datasheet | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) |
| Citations for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) – 2 Found |
| Günther, Claudia; Zimmermann, Nick; Berndt, Nicole; Grosser, Marianne; Stein, Annette; Koch, Andre; Meurer, Michael. Up-regulation of the chemokine CCL18 by macrophages is a potential immunomodulatory pathway in cutaneous T-cell lymphoma. The American Journal Of Pathology. 2011;179(3):1434-42. PubMed |
| Günther, C; Starke, J; Zimmermann, N; Schäkel, K. Human 6-sulfo LacNAc (slan) dendritic cells are a major population of dermal dendritic cells in steady state and inflammation. Clinical And Experimental Dermatology. 2012;37(2):169-76. PubMed |