Anti CD1A pAb (ATL-HPA010734 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010734-25

• 

Protein Description: CD1a molecule
Gene Name: CD1A
Alternative Gene Name: CD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 37%, ENSRNOG00000016451: 35%
Entrez Gene ID: 909
Uniprot ID: P06126
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND
• Gene Sequence: QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND
• Gene ID - Mouse: ENSMUSG00000028076
• Gene ID - Rat: ENSRNOG00000016451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD1A pAb (ATL-HPA010734 w/enhanced validation) – 2 Found

Günther, Claudia; Zimmermann, Nick; Berndt, Nicole; Grosser, Marianne; Stein, Annette; Koch, Andre; Meurer, Michael. Up-regulation of the chemokine CCL18 by macrophages is a potential immunomodulatory pathway in cutaneous T-cell lymphoma. The American Journal Of Pathology. 2011;179(3):1434-42. 

Günther, C; Starke, J; Zimmermann, N; Schäkel, K. Human 6-sulfo LacNAc (slan) dendritic cells are a major population of dermal dendritic cells in steady state and inflammation. Clinical And Experimental Dermatology. 2012;37(2):169-76.