Anti CD177 pAb (ATL-HPA077640 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA077640-25
  • Immunohistochemistry analysis in human bone marrow and duodenum tissues using Anti-CD177 antibody. Corresponding CD177 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CD177 molecule
Gene Name: CD177
Alternative Gene Name: HNA2A, NB1, PRV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052212: 49%, ENSRNOG00000022669: 46%
Entrez Gene ID: 57126
Uniprot ID: Q8N6Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG
Gene Sequence GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG
Gene ID - Mouse ENSMUSG00000052212
Gene ID - Rat ENSRNOG00000022669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD177 pAb (ATL-HPA077640 w/enhanced validation)
Datasheet Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD177 pAb (ATL-HPA077640 w/enhanced validation)
Datasheet Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD177 pAb (ATL-HPA077640 w/enhanced validation)