Anti CD164 pAb (ATL-HPA010636)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010636-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CD164
Alternative Gene Name: MGC-24, MUC-24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019818: 51%, ENSRNOG00000000304: 49%
Entrez Gene ID: 8763
Uniprot ID: Q04900
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTS |
Gene Sequence | TQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTS |
Gene ID - Mouse | ENSMUSG00000019818 |
Gene ID - Rat | ENSRNOG00000000304 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD164 pAb (ATL-HPA010636) | |
Datasheet | Anti CD164 pAb (ATL-HPA010636) Datasheet (External Link) |
Vendor Page | Anti CD164 pAb (ATL-HPA010636) at Atlas Antibodies |
Documents & Links for Anti CD164 pAb (ATL-HPA010636) | |
Datasheet | Anti CD164 pAb (ATL-HPA010636) Datasheet (External Link) |
Vendor Page | Anti CD164 pAb (ATL-HPA010636) |
Citations for Anti CD164 pAb (ATL-HPA010636) – 3 Found |
Chen, Jia-Hong; Chen, Wei-Liang; Chan, James Yi-Hsin; Chen, Yuan-Wu; Peng, Yi-Jen; Cheng, Ming-Fang; Lin, Chun-Shu. Overexpression of CD164 in oral cavity squamous cell carcinoma predicts a favourable prognosis. Oncology Letters. 2017;14(5):6103-6108. PubMed |
Chan, Charles K F; Gulati, Gunsagar S; Sinha, Rahul; Tompkins, Justin Vincent; Lopez, Michael; Carter, Ava C; Ransom, Ryan C; Reinisch, Andreas; Wearda, Taylor; Murphy, Matthew; Brewer, Rachel E; Koepke, Lauren S; Marecic, Owen; Manjunath, Anoop; Seo, Eun Young; Leavitt, Tripp; Lu, Wan-Jin; Nguyen, Allison; Conley, Stephanie D; Salhotra, Ankit; Ambrosi, Thomas H; Borrelli, Mimi R; Siebel, Taylor; Chan, Karen; Schallmoser, Katharina; Seita, Jun; Sahoo, Debashis; Goodnough, Henry; Bishop, Julius; Gardner, Michael; Majeti, Ravindra; Wan, Derrick C; Goodman, Stuart; Weissman, Irving L; Chang, Howard Y; Longaker, Michael T. Identification of the Human Skeletal Stem Cell. Cell. 2018;175(1):43-56.e21. PubMed |
Zhang, Xin-Wu; Li, Shun-Le; Zhang, Di; Sun, Xiao-Li; Zhai, Hong-Jun. RP11‑619L19.2 promotes colon cancer development by regulating the miR‑1271‑5p/CD164 axis. Oncology Reports. 2020;44(6):2419-2428. PubMed |