Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA015663-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CD163 molecule-like 1
Gene Name: CD163L1
Alternative Gene Name: CD163B, M160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028041: 33%, ENSRNOG00000009585: 27%
Entrez Gene ID: 283316
Uniprot ID: Q9NR16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
Gene Sequence LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
Gene ID - Mouse ENSMUSG00000028041
Gene ID - Rat ENSRNOG00000009585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation)
Datasheet Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation)
Datasheet Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation)
Citations for Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) – 1 Found
Rubio-Navarro, Alfonso; Carril, Mónica; Padro, Daniel; Guerrero-Hue, Melanie; Tarín, Carlos; Samaniego, Rafael; Cannata, Pablo; Cano, Ainhoa; Villalobos, Juan Manuel Amaro; Sevillano, Ángel Manuel; Yuste, Claudia; Gutiérrez, Eduardo; Praga, Manuel; Egido, Jesús; Moreno, Juan Antonio. CD163-Macrophages Are Involved in Rhabdomyolysis-Induced Kidney Injury and May Be Detected by MRI with Targeted Gold-Coated Iron Oxide Nanoparticles. Theranostics. 6(6):896-914.  PubMed