Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015663-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CD163L1
Alternative Gene Name: CD163B, M160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028041: 33%, ENSRNOG00000009585: 27%
Entrez Gene ID: 283316
Uniprot ID: Q9NR16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT |
Gene Sequence | LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT |
Gene ID - Mouse | ENSMUSG00000028041 |
Gene ID - Rat | ENSRNOG00000009585 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) | |
Datasheet | Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) | |
Datasheet | Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) |
Citations for Anti CD163L1 pAb (ATL-HPA015663 w/enhanced validation) – 1 Found |
Rubio-Navarro, Alfonso; Carril, Mónica; Padro, Daniel; Guerrero-Hue, Melanie; Tarín, Carlos; Samaniego, Rafael; Cannata, Pablo; Cano, Ainhoa; Villalobos, Juan Manuel Amaro; Sevillano, Ángel Manuel; Yuste, Claudia; Gutiérrez, Eduardo; Praga, Manuel; Egido, Jesús; Moreno, Juan Antonio. CD163-Macrophages Are Involved in Rhabdomyolysis-Induced Kidney Injury and May Be Detected by MRI with Targeted Gold-Coated Iron Oxide Nanoparticles. Theranostics. 6(6):896-914. PubMed |