Anti CD163 pAb (ATL-HPA046404 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA046404-25

Protein Description: CD163 molecule
Gene Name: CD163
Alternative Gene Name: M130, MM130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008845: 51%, ENSRNOG00000010253: 30%
Entrez Gene ID: 9332
Uniprot ID: Q86VB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN
• Gene Sequence: SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN
• Gene ID - Mouse: ENSMUSG00000008845
• Gene ID - Rat: ENSRNOG00000010253
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) – 1 Found

Lundgren, Sebastian; Micke, Patrick; Elebro, Jacob; Heby, Margareta; Hrynchyk, Ina; Nodin, Björn; Leandersson, Karin; Mezheyeuski, Artur; Jirström, Karin. Topographical Distribution and Spatial Interactions of Innate and Semi-Innate Immune Cells in Pancreatic and Other Periampullary Adenocarcinoma. Frontiers In Immunology. 11( 33013928):558169.