Anti CD163 pAb (ATL-HPA046404 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046404-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CD163
Alternative Gene Name: M130, MM130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008845: 51%, ENSRNOG00000010253: 30%
Entrez Gene ID: 9332
Uniprot ID: Q86VB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN |
| Gene Sequence | SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN |
| Gene ID - Mouse | ENSMUSG00000008845 |
| Gene ID - Rat | ENSRNOG00000010253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) | |
| Datasheet | Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) | |
| Datasheet | Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) |
| Citations for Anti CD163 pAb (ATL-HPA046404 w/enhanced validation) – 1 Found |
| Lundgren, Sebastian; Micke, Patrick; Elebro, Jacob; Heby, Margareta; Hrynchyk, Ina; Nodin, Björn; Leandersson, Karin; Mezheyeuski, Artur; Jirström, Karin. Topographical Distribution and Spatial Interactions of Innate and Semi-Innate Immune Cells in Pancreatic and Other Periampullary Adenocarcinoma. Frontiers In Immunology. 11( 33013928):558169. PubMed |