Anti CD151 pAb (ATL-HPA011906)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011906-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD151
Alternative Gene Name: PETA-3, RAPH, SFA-1, TSPAN24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025510: 88%, ENSRNOG00000019215: 86%
Entrez Gene ID: 977
Uniprot ID: P48509
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF |
| Gene Sequence | LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF |
| Gene ID - Mouse | ENSMUSG00000025510 |
| Gene ID - Rat | ENSRNOG00000019215 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD151 pAb (ATL-HPA011906) | |
| Datasheet | Anti CD151 pAb (ATL-HPA011906) Datasheet (External Link) |
| Vendor Page | Anti CD151 pAb (ATL-HPA011906) at Atlas Antibodies |
| Documents & Links for Anti CD151 pAb (ATL-HPA011906) | |
| Datasheet | Anti CD151 pAb (ATL-HPA011906) Datasheet (External Link) |
| Vendor Page | Anti CD151 pAb (ATL-HPA011906) |
| Citations for Anti CD151 pAb (ATL-HPA011906) – 1 Found |
| Lin, Wanzun; Liu, Jun; Chen, Juhui; Li, Jiancheng; Qiu, Sufang; Ma, Jiayu; Lin, Xiandong; Zhang, Lurong; Wu, Junxin. Peptides of tetraspanin oncoprotein CD151 trigger active immunity against primary tumour and experimental lung metastasis. Ebiomedicine. 2019;49( 31668880):133-144. PubMed |