Anti CD151 pAb (ATL-HPA011906)

Atlas Antibodies

SKU: ATL-HPA011906-25

• 

Protein Description: CD151 molecule (Raph blood group)
Gene Name: CD151
Alternative Gene Name: PETA-3, RAPH, SFA-1, TSPAN24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025510: 88%, ENSRNOG00000019215: 86%
Entrez Gene ID: 977
Uniprot ID: P48509
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF
• Gene Sequence: LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF
• Gene ID - Mouse: ENSMUSG00000025510
• Gene ID - Rat: ENSRNOG00000019215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD151 pAb (ATL-HPA011906) – 1 Found

Lin, Wanzun; Liu, Jun; Chen, Juhui; Li, Jiancheng; Qiu, Sufang; Ma, Jiayu; Lin, Xiandong; Zhang, Lurong; Wu, Junxin. Peptides of tetraspanin oncoprotein CD151 trigger active immunity against primary tumour and experimental lung metastasis. Ebiomedicine. 2019;49( 31668880):133-144.