Anti CD14 pAb (ATL-HPA002127 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002127-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CD14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051439: 65%, ENSRNOG00000017819: 63%
Entrez Gene ID: 929
Uniprot ID: P08571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG |
| Gene Sequence | LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG |
| Gene ID - Mouse | ENSMUSG00000051439 |
| Gene ID - Rat | ENSRNOG00000017819 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD14 pAb (ATL-HPA002127 w/enhanced validation) | |
| Datasheet | Anti CD14 pAb (ATL-HPA002127 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD14 pAb (ATL-HPA002127 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD14 pAb (ATL-HPA002127 w/enhanced validation) | |
| Datasheet | Anti CD14 pAb (ATL-HPA002127 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD14 pAb (ATL-HPA002127 w/enhanced validation) |
| Citations for Anti CD14 pAb (ATL-HPA002127 w/enhanced validation) – 5 Found |
| Scalia, Carla Rossana; Gendusa, Rossella; Basciu, Maria; Riva, Lorella; Tusa, Lorenza; Musarò, Antonella; Veronese, Silvio; Formenti, Angelo; D'Angelo, Donatella; Ronzio, Angela Gabriella; Cattoretti, Giorgio; Bolognesi, Maddalena Maria. Epitope recognition in the human-pig comparison model on fixed and embedded material. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2015;63(10):805-22. PubMed |
| Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Mascadri, Francesco; Bolognesi, Maddalena M; Pilla, Daniela; Cattoretti, Giorgio. Rejuvenated Vintage Tissue Sections Highlight Individual Antigen Fate During Processing and Long-term Storage. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2021;69(10):659-667. PubMed |