Anti CD14 pAb (ATL-HPA001887 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001887-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: CD14 molecule
Gene Name: CD14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051439: 57%, ENSRNOG00000017819: 55%
Entrez Gene ID: 929
Uniprot ID: P08571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Gene Sequence PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Gene ID - Mouse ENSMUSG00000051439
Gene ID - Rat ENSRNOG00000017819
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD14 pAb (ATL-HPA001887 w/enhanced validation)
Datasheet Anti CD14 pAb (ATL-HPA001887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD14 pAb (ATL-HPA001887 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD14 pAb (ATL-HPA001887 w/enhanced validation)
Datasheet Anti CD14 pAb (ATL-HPA001887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD14 pAb (ATL-HPA001887 w/enhanced validation)
Citations for Anti CD14 pAb (ATL-HPA001887 w/enhanced validation) – 10 Found
Hingorani, Pooja; Maas, Mary L; Gustafson, Michael P; Dickman, Paul; Adams, Roberta H; Watanabe, Masayo; Eshun, Francis; Williams, James; Seidel, Matthew J; Dietz, Allan B. Increased CTLA-4(+) T cells and an increased ratio of monocytes with loss of class II (CD14(+) HLA-DR(lo/neg)) found in aggressive pediatric sarcoma patients. Journal For Immunotherapy Of Cancer. 3( 26286851):35.  PubMed
Meinhardt, Gudrun; Saleh, Leila; Otti, Gerlinde R; Haider, Sandra; Velicky, Philipp; Fiala, Christian; Pollheimer, Jürgen; Knöfler, Martin. Wingless ligand 5a is a critical regulator of placental growth and survival. Scientific Reports. 2016;6( 27311852):28127.  PubMed
Nayar, Shikha; Morrison, Joshua K; Giri, Mamta; Gettler, Kyle; Chuang, Ling-Shiang; Walker, Laura A; Ko, Huaibin M; Kenigsberg, Ephraim; Kugathasan, Subra; Merad, Miriam; Chu, Jaime; Cho, Judy H. A myeloid-stromal niche and gp130 rescue in NOD2-driven Crohn's disease. Nature. 2021;593(7858):275-281.  PubMed
Zimmermann, Henning W; Seidler, Sebastian; Nattermann, Jacob; Gassler, Nikolaus; Hellerbrand, Claus; Zernecke, Alma; Tischendorf, Jens J W; Luedde, Tom; Weiskirchen, Ralf; Trautwein, Christian; Tacke, Frank. Functional contribution of elevated circulating and hepatic non-classical CD14CD16 monocytes to inflammation and human liver fibrosis. Plos One. 2010;5(6):e11049.  PubMed
Fruhwürth, Stefanie; Pavelka, Margit; Bittman, Robert; Kovacs, Werner J; Walter, Katharina M; Röhrl, Clemens; Stangl, Herbert. High-density lipoprotein endocytosis in endothelial cells. World Journal Of Biological Chemistry. 2013;4(4):131-40.  PubMed
Tarassishin, Leonid; Suh, Hyeon-Sook; Lee, Sunhee C. LPS and IL-1 differentially activate mouse and human astrocytes: role of CD14. Glia. 2014;62(6):999-1013.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Maus, Rachel L G; Jakub, James W; Hieken, Tina J; Nevala, Wendy K; Christensen, Trace A; Sutor, Shari L; Flotte, Thomas J; Markovic, Svetomir N. Identification of novel, immune-mediating extracellular vesicles in human lymphatic effluent draining primary cutaneous melanoma. Oncoimmunology. 8(12):e1667742.  PubMed
Golubinskaya, Veronika; Puttonen, Henri; Fyhr, Ing-Marie; Rydbeck, Halfdan; Hellström, Ann; Jacobsson, Bo; Nilsson, Holger; Mallard, Carina; Sävman, Karin. Expression of S100A Alarmins in Cord Blood Monocytes Is Highly Associated With Chorioamnionitis and Fetal Inflammation in Preterm Infants. Frontiers In Immunology. 11( 32612607):1194.  PubMed
Carr, Ryan M; Vorobyev, Denis; Lasho, Terra; Marks, David L; Tolosa, Ezequiel J; Vedder, Alexis; Almada, Luciana L; Yurcheko, Andrey; Padioleau, Ismael; Alver, Bonnie; Coltro, Giacomo; Binder, Moritz; Safgren, Stephanie L; Horn, Isaac; You, Xiaona; Solary, Eric; Balasis, Maria E; Berger, Kurt; Hiebert, James; Witzig, Thomas; Buradkar, Ajinkya; Graf, Temeida; Valent, Peter; Mangaonkar, Abhishek A; Robertson, Keith D; Howard, Matthew T; Kaufmann, Scott H; Pin, Christopher; Fernandez-Zapico, Martin E; Geissler, Klaus; Droin, Nathalie; Padron, Eric; Zhang, Jing; Nikolaev, Sergey; Patnaik, Mrinal M. RAS mutations drive proliferative chronic myelomonocytic leukemia via a KMT2A-PLK1 axis. Nature Communications. 2021;12(1):2901.  PubMed