Anti CCZ1 pAb (ATL-HPA050006)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050006-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CCZ1
Alternative Gene Name: C7orf28A, CCZ1A, CGI-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029617: 97%, ENSRNOG00000001032: 97%
Entrez Gene ID: 51622
Uniprot ID: P86791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY |
Gene Sequence | LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY |
Gene ID - Mouse | ENSMUSG00000029617 |
Gene ID - Rat | ENSRNOG00000001032 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCZ1 pAb (ATL-HPA050006) | |
Datasheet | Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link) |
Vendor Page | Anti CCZ1 pAb (ATL-HPA050006) at Atlas Antibodies |
Documents & Links for Anti CCZ1 pAb (ATL-HPA050006) | |
Datasheet | Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link) |
Vendor Page | Anti CCZ1 pAb (ATL-HPA050006) |