Anti CCZ1 pAb (ATL-HPA045114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045114-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CCZ1
Alternative Gene Name: C7orf28A, CCZ1A, CGI-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029617: 95%, ENSRNOG00000001032: 95%
Entrez Gene ID: 51622
Uniprot ID: P86791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EMPGNLQHYGRFLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCRRLDSIVGPQLTVLASDICEQFNINKRMSGSEK |
| Gene Sequence | EMPGNLQHYGRFLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCRRLDSIVGPQLTVLASDICEQFNINKRMSGSEK |
| Gene ID - Mouse | ENSMUSG00000029617 |
| Gene ID - Rat | ENSRNOG00000001032 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCZ1 pAb (ATL-HPA045114) | |
| Datasheet | Anti CCZ1 pAb (ATL-HPA045114) Datasheet (External Link) |
| Vendor Page | Anti CCZ1 pAb (ATL-HPA045114) at Atlas Antibodies |
| Documents & Links for Anti CCZ1 pAb (ATL-HPA045114) | |
| Datasheet | Anti CCZ1 pAb (ATL-HPA045114) Datasheet (External Link) |
| Vendor Page | Anti CCZ1 pAb (ATL-HPA045114) |
| Citations for Anti CCZ1 pAb (ATL-HPA045114) – 1 Found |
| Kvainickas, Arunas; Nägele, Heike; Qi, Wenjing; Dokládal, Ladislav; Jimenez-Orgaz, Ana; Stehl, Luca; Gangurde, Dipak; Zhao, Qian; Hu, Zehan; Dengjel, Jörn; De Virgilio, Claudio; Baumeister, Ralf; Steinberg, Florian. Retromer and TBC1D5 maintain late endosomal RAB7 domains to enable amino acid-induced mTORC1 signaling. The Journal Of Cell Biology. 2019;218(9):3019-3038. PubMed |