Anti CCT8 pAb (ATL-HPA029426 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029426-25
  • Immunohistochemical staining of human cerebral cortex, lymph node, testis and urinary bladder using Anti-CCT8 antibody HPA029426 (A) shows similar protein distribution across tissues to independent antibody HPA018520 (B).
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.
  • Western blot analysis using Anti-CCT8 antibody HPA029426 (A) shows similar pattern to independent antibody HPA018520 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chaperonin containing TCP1, subunit 8 (theta)
Gene Name: CCT8
Alternative Gene Name: C21orf112, Cctq, PRED71
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025613: 96%, ENSRNOG00000001592: 98%
Entrez Gene ID: 10694
Uniprot ID: P50990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVV
Gene Sequence VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVV
Gene ID - Mouse ENSMUSG00000025613
Gene ID - Rat ENSRNOG00000001592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCT8 pAb (ATL-HPA029426 w/enhanced validation)
Datasheet Anti CCT8 pAb (ATL-HPA029426 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCT8 pAb (ATL-HPA029426 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCT8 pAb (ATL-HPA029426 w/enhanced validation)
Datasheet Anti CCT8 pAb (ATL-HPA029426 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCT8 pAb (ATL-HPA029426 w/enhanced validation)