Anti CCT6A pAb (ATL-HPA049949)

Atlas Antibodies

Catalog No.: ATL-HPA049949-100

Protein Description: chaperonin containing TCP1, subunit 6A (zeta 1)
Gene Name: CCT6A
Alternative Gene Name: CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020698: 90%, ENSRNOG00000000923: 95%
Entrez Gene ID: 908
Uniprot ID: P40227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK
• Gene Sequence: DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK
• Gene ID - Mouse: ENSMUSG00000020698
• Gene ID - Rat: ENSRNOG00000000923
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.