Anti CCT6A pAb (ATL-HPA049949)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049949-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CCT6A
Alternative Gene Name: CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020698: 90%, ENSRNOG00000000923: 95%
Entrez Gene ID: 908
Uniprot ID: P40227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK |
Gene Sequence | DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK |
Gene ID - Mouse | ENSMUSG00000020698 |
Gene ID - Rat | ENSRNOG00000000923 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCT6A pAb (ATL-HPA049949) | |
Datasheet | Anti CCT6A pAb (ATL-HPA049949) Datasheet (External Link) |
Vendor Page | Anti CCT6A pAb (ATL-HPA049949) at Atlas Antibodies |
Documents & Links for Anti CCT6A pAb (ATL-HPA049949) | |
Datasheet | Anti CCT6A pAb (ATL-HPA049949) Datasheet (External Link) |
Vendor Page | Anti CCT6A pAb (ATL-HPA049949) |