Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042996-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chaperonin containing TCP1, subunit 6A (zeta 1)
Gene Name: CCT6A
Alternative Gene Name: CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020698: 92%, ENSRNOG00000000923: 100%
Entrez Gene ID: 908
Uniprot ID: P40227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK
Gene Sequence GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK
Gene ID - Mouse ENSMUSG00000020698
Gene ID - Rat ENSRNOG00000000923
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation)
Datasheet Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation)
Datasheet Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation)
Citations for Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) – 1 Found
Huang, Kai; Zeng, Yi; Xie, Yunqing; Huang, Liying; Wu, Yu. Bioinformatics analysis of the prognostic value of CCT6A and associated signalling pathways in breast cancer. Molecular Medicine Reports. 2019;19(5):4344-4352.  PubMed