Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042996-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CCT6A
Alternative Gene Name: CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020698: 92%, ENSRNOG00000000923: 100%
Entrez Gene ID: 908
Uniprot ID: P40227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK |
Gene Sequence | GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK |
Gene ID - Mouse | ENSMUSG00000020698 |
Gene ID - Rat | ENSRNOG00000000923 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) | |
Datasheet | Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) | |
Datasheet | Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) |
Citations for Anti CCT6A pAb (ATL-HPA042996 w/enhanced validation) – 1 Found |
Huang, Kai; Zeng, Yi; Xie, Yunqing; Huang, Liying; Wu, Yu. Bioinformatics analysis of the prognostic value of CCT6A and associated signalling pathways in breast cancer. Molecular Medicine Reports. 2019;19(5):4344-4352. PubMed |