Anti CCSER2 pAb (ATL-HPA037482)

Atlas Antibodies

Catalog No.: ATL-HPA037482-25

Protein Description: coiled-coil serine-rich protein 2
Gene Name: CCSER2
Alternative Gene Name: FAM190B, KIAA1128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058690: 92%, ENSRNOG00000022781: 92%
Entrez Gene ID: 54462
Uniprot ID: Q9H7U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVECDNMNRFDRPDRNVRQPQEGFWKRPPQRWSGQEHYHLSHPDHYHHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT
• Gene Sequence: NVECDNMNRFDRPDRNVRQPQEGFWKRPPQRWSGQEHYHLSHPDHYHHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT
• Gene ID - Mouse: ENSMUSG00000058690
• Gene ID - Rat: ENSRNOG00000022781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.