Anti CCSER2 pAb (ATL-HPA037482)

Atlas Antibodies

Catalog No.:
ATL-HPA037482-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil serine-rich protein 2
Gene Name: CCSER2
Alternative Gene Name: FAM190B, KIAA1128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058690: 92%, ENSRNOG00000022781: 92%
Entrez Gene ID: 54462
Uniprot ID: Q9H7U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NVECDNMNRFDRPDRNVRQPQEGFWKRPPQRWSGQEHYHLSHPDHYHHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT
Gene Sequence NVECDNMNRFDRPDRNVRQPQEGFWKRPPQRWSGQEHYHLSHPDHYHHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT
Gene ID - Mouse ENSMUSG00000058690
Gene ID - Rat ENSRNOG00000022781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCSER2 pAb (ATL-HPA037482)
Datasheet Anti CCSER2 pAb (ATL-HPA037482) Datasheet (External Link)
Vendor Page Anti CCSER2 pAb (ATL-HPA037482) at Atlas Antibodies

Documents & Links for Anti CCSER2 pAb (ATL-HPA037482)
Datasheet Anti CCSER2 pAb (ATL-HPA037482) Datasheet (External Link)
Vendor Page Anti CCSER2 pAb (ATL-HPA037482)