Anti CCSER2 pAb (ATL-HPA037481)

Atlas Antibodies

SKU:
ATL-HPA037481-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in Leydig cells.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line SK-MEL-30
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil serine-rich protein 2
Gene Name: CCSER2
Alternative Gene Name: FAM190B, KIAA1128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058690: 87%, ENSRNOG00000022781: 60%
Entrez Gene ID: 54462
Uniprot ID: Q9H7U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQLLELQLATQHICHQKCKEEKCTYADKYTQTPWRRIPGGYSAPSFSPWQGSFQGIPRTVPPHRRQTSSTTAFQQPSQTHRSHPGKTNKATT
Gene Sequence IQLLELQLATQHICHQKCKEEKCTYADKYTQTPWRRIPGGYSAPSFSPWQGSFQGIPRTVPPHRRQTSSTTAFQQPSQTHRSHPGKTNKATT
Gene ID - Mouse ENSMUSG00000058690
Gene ID - Rat ENSRNOG00000022781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCSER2 pAb (ATL-HPA037481)
Datasheet Anti CCSER2 pAb (ATL-HPA037481) Datasheet (External Link)
Vendor Page Anti CCSER2 pAb (ATL-HPA037481) at Atlas Antibodies

Documents & Links for Anti CCSER2 pAb (ATL-HPA037481)
Datasheet Anti CCSER2 pAb (ATL-HPA037481) Datasheet (External Link)
Vendor Page Anti CCSER2 pAb (ATL-HPA037481)