Anti CCSAP pAb (ATL-HPA028402 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028402-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: centriole, cilia and spindle-associated protein
Gene Name: CCSAP
Alternative Gene Name: C1orf96, CSAP, FLJ41471
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031971: 85%, ENSRNOG00000017690: 86%
Entrez Gene ID: 126731
Uniprot ID: Q6IQ19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA
Gene Sequence KQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA
Gene ID - Mouse ENSMUSG00000031971
Gene ID - Rat ENSRNOG00000017690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCSAP pAb (ATL-HPA028402 w/enhanced validation)
Datasheet Anti CCSAP pAb (ATL-HPA028402 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCSAP pAb (ATL-HPA028402 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCSAP pAb (ATL-HPA028402 w/enhanced validation)
Datasheet Anti CCSAP pAb (ATL-HPA028402 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCSAP pAb (ATL-HPA028402 w/enhanced validation)