Anti CCS pAb (ATL-HPA044090)

Atlas Antibodies

SKU:
ATL-HPA044090-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: copper chaperone for superoxide dismutase
Gene Name: CCS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034108: 86%, ENSRNOG00000047816: 84%
Entrez Gene ID: 9973
Uniprot ID: O14618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHR
Gene Sequence GQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHR
Gene ID - Mouse ENSMUSG00000034108
Gene ID - Rat ENSRNOG00000047816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCS pAb (ATL-HPA044090)
Datasheet Anti CCS pAb (ATL-HPA044090) Datasheet (External Link)
Vendor Page Anti CCS pAb (ATL-HPA044090) at Atlas Antibodies

Documents & Links for Anti CCS pAb (ATL-HPA044090)
Datasheet Anti CCS pAb (ATL-HPA044090) Datasheet (External Link)
Vendor Page Anti CCS pAb (ATL-HPA044090)