Anti CCS pAb (ATL-HPA044090)

Atlas Antibodies

Catalog No.: ATL-HPA044090-25

Protein Description: copper chaperone for superoxide dismutase
Gene Name: CCS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034108: 86%, ENSRNOG00000047816: 84%
Entrez Gene ID: 9973
Uniprot ID: O14618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHR
• Gene Sequence: GQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHR
• Gene ID - Mouse: ENSMUSG00000034108
• Gene ID - Rat: ENSRNOG00000047816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.