Anti CCS pAb (ATL-HPA040026)

Atlas Antibodies

Catalog No.:
ATL-HPA040026-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: copper chaperone for superoxide dismutase
Gene Name: CCS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034108: 81%, ENSRNOG00000047816: 79%
Entrez Gene ID: 9973
Uniprot ID: O14618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGS
Gene Sequence SDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGS
Gene ID - Mouse ENSMUSG00000034108
Gene ID - Rat ENSRNOG00000047816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCS pAb (ATL-HPA040026)
Datasheet Anti CCS pAb (ATL-HPA040026) Datasheet (External Link)
Vendor Page Anti CCS pAb (ATL-HPA040026) at Atlas Antibodies

Documents & Links for Anti CCS pAb (ATL-HPA040026)
Datasheet Anti CCS pAb (ATL-HPA040026) Datasheet (External Link)
Vendor Page Anti CCS pAb (ATL-HPA040026)