Anti CCRL2 pAb (ATL-HPA043238)

Atlas Antibodies

SKU: ATL-HPA043238-25

• 
• 

Protein Description: chemokine (C-C motif) receptor-like 2
Gene Name: CCRL2
Alternative Gene Name: ACKR5, CKRX, CRAM-A, CRAM-B, HCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031442: 38%, ENSRNOG00000020513: 35%
Entrez Gene ID: 9034
Uniprot ID: O00421
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
• Gene Sequence: FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
• Gene ID - Mouse: ENSMUSG00000031442
• Gene ID - Rat: ENSRNOG00000020513
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.