Anti CCR7 pAb (ATL-HPA074467)

Atlas Antibodies

Catalog No.: ATL-HPA074467-25

Protein Description: chemokine (C-C motif) receptor 7
Gene Name: CCR7
Alternative Gene Name: BLR2, CD197, CDw197, CMKBR7, EBI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037944: 88%, ENSRNOG00000010665: 88%
Entrez Gene ID: 1236
Uniprot ID: P32248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA
• Gene Sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA
• Gene ID - Mouse: ENSMUSG00000037944
• Gene ID - Rat: ENSRNOG00000010665
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.