Anti CCR7 pAb (ATL-HPA031383)

Atlas Antibodies

SKU:
ATL-HPA031383-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chemokine (C-C motif) receptor 7
Gene Name: CCR7
Alternative Gene Name: BLR2, CD197, CDw197, CMKBR7, EBI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037944: 83%, ENSRNOG00000010665: 85%
Entrez Gene ID: 1236
Uniprot ID: P32248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS
Gene Sequence GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS
Gene ID - Mouse ENSMUSG00000037944
Gene ID - Rat ENSRNOG00000010665
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCR7 pAb (ATL-HPA031383)
Datasheet Anti CCR7 pAb (ATL-HPA031383) Datasheet (External Link)
Vendor Page Anti CCR7 pAb (ATL-HPA031383) at Atlas Antibodies

Documents & Links for Anti CCR7 pAb (ATL-HPA031383)
Datasheet Anti CCR7 pAb (ATL-HPA031383) Datasheet (External Link)
Vendor Page Anti CCR7 pAb (ATL-HPA031383)