Anti CCR3 pAb (ATL-HPA069514)

Atlas Antibodies

Catalog No.:
ATL-HPA069514-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: C-C motif chemokine receptor 3
Gene Name: CCR3
Alternative Gene Name: CC-CKR-3, CD193, CKR3, CMKBR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035448: 47%, ENSRNOG00000006736: 44%
Entrez Gene ID: 1232
Uniprot ID: P51677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI
Gene Sequence YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI
Gene ID - Mouse ENSMUSG00000035448
Gene ID - Rat ENSRNOG00000006736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCR3 pAb (ATL-HPA069514)
Datasheet Anti CCR3 pAb (ATL-HPA069514) Datasheet (External Link)
Vendor Page Anti CCR3 pAb (ATL-HPA069514) at Atlas Antibodies

Documents & Links for Anti CCR3 pAb (ATL-HPA069514)
Datasheet Anti CCR3 pAb (ATL-HPA069514) Datasheet (External Link)
Vendor Page Anti CCR3 pAb (ATL-HPA069514)