Anti CCPG1 pAb (ATL-HPA026861)

Atlas Antibodies

Catalog No.:
ATL-HPA026861-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cell cycle progression 1
Gene Name: CCPG1
Alternative Gene Name: CPR8, KIAA1254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034563: 76%, ENSRNOG00000053428: 73%
Entrez Gene ID: 9236
Uniprot ID: Q9ULG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL
Gene Sequence DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL
Gene ID - Mouse ENSMUSG00000034563
Gene ID - Rat ENSRNOG00000053428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCPG1 pAb (ATL-HPA026861)
Datasheet Anti CCPG1 pAb (ATL-HPA026861) Datasheet (External Link)
Vendor Page Anti CCPG1 pAb (ATL-HPA026861) at Atlas Antibodies

Documents & Links for Anti CCPG1 pAb (ATL-HPA026861)
Datasheet Anti CCPG1 pAb (ATL-HPA026861) Datasheet (External Link)
Vendor Page Anti CCPG1 pAb (ATL-HPA026861)
Citations for Anti CCPG1 pAb (ATL-HPA026861) – 2 Found
Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245.  PubMed
Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244.  PubMed