Anti CCNT1 pAb (ATL-HPA072012)

Atlas Antibodies

Catalog No.:
ATL-HPA072012-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cyclin T1
Gene Name: CCNT1
Alternative Gene Name: CCNT, CYCT1, HIVE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011960: 89%, ENSRNOG00000053054: 93%
Entrez Gene ID: 904
Uniprot ID: O60563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV
Gene Sequence MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV
Gene ID - Mouse ENSMUSG00000011960
Gene ID - Rat ENSRNOG00000053054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNT1 pAb (ATL-HPA072012)
Datasheet Anti CCNT1 pAb (ATL-HPA072012) Datasheet (External Link)
Vendor Page Anti CCNT1 pAb (ATL-HPA072012) at Atlas Antibodies

Documents & Links for Anti CCNT1 pAb (ATL-HPA072012)
Datasheet Anti CCNT1 pAb (ATL-HPA072012) Datasheet (External Link)
Vendor Page Anti CCNT1 pAb (ATL-HPA072012)