Anti CCNL2 pAb (ATL-HPA053137)

Atlas Antibodies

Catalog No.:
ATL-HPA053137-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclin L2
Gene Name: CCNL2
Alternative Gene Name: ania-6b, CCNM, CCNS, HLA-ISO, PCEE, SB138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029068: 96%, ENSRNOG00000018691: 96%
Entrez Gene ID: 81669
Uniprot ID: Q96S94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
Gene Sequence DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
Gene ID - Mouse ENSMUSG00000029068
Gene ID - Rat ENSRNOG00000018691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNL2 pAb (ATL-HPA053137)
Datasheet Anti CCNL2 pAb (ATL-HPA053137) Datasheet (External Link)
Vendor Page Anti CCNL2 pAb (ATL-HPA053137) at Atlas Antibodies

Documents & Links for Anti CCNL2 pAb (ATL-HPA053137)
Datasheet Anti CCNL2 pAb (ATL-HPA053137) Datasheet (External Link)
Vendor Page Anti CCNL2 pAb (ATL-HPA053137)