Anti CCNL1 pAb (ATL-HPA057911)

Atlas Antibodies

Catalog No.:
ATL-HPA057911-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cyclin L1
Gene Name: CCNL1
Alternative Gene Name: ania-6a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027829: 96%, ENSRNOG00000011586: 98%
Entrez Gene ID: 57018
Uniprot ID: Q9UK58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKPSSPREVKAEEKSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRS
Gene Sequence SKPSSPREVKAEEKSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRS
Gene ID - Mouse ENSMUSG00000027829
Gene ID - Rat ENSRNOG00000011586
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNL1 pAb (ATL-HPA057911)
Datasheet Anti CCNL1 pAb (ATL-HPA057911) Datasheet (External Link)
Vendor Page Anti CCNL1 pAb (ATL-HPA057911) at Atlas Antibodies

Documents & Links for Anti CCNL1 pAb (ATL-HPA057911)
Datasheet Anti CCNL1 pAb (ATL-HPA057911) Datasheet (External Link)
Vendor Page Anti CCNL1 pAb (ATL-HPA057911)