Anti CCNI2 pAb (ATL-HPA056288)

Atlas Antibodies

Catalog No.:
ATL-HPA056288-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cyclin I family, member 2
Gene Name: CCNI2
Alternative Gene Name: FLJ16793
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063015: 45%, ENSRNOG00000002125: 46%
Entrez Gene ID: 645121
Uniprot ID: Q6ZMN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LELLPQRNPSLHVASLTRQLQHCMAGHQLLQFKGSTLALVIITLELERLMPGWCAPISDLLKKAQVGDMQYSCCKELVMQQLRSLQSSSCTDNFVSPAN
Gene Sequence LELLPQRNPSLHVASLTRQLQHCMAGHQLLQFKGSTLALVIITLELERLMPGWCAPISDLLKKAQVGDMQYSCCKELVMQQLRSLQSSSCTDNFVSPAN
Gene ID - Mouse ENSMUSG00000063015
Gene ID - Rat ENSRNOG00000002125
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNI2 pAb (ATL-HPA056288)
Datasheet Anti CCNI2 pAb (ATL-HPA056288) Datasheet (External Link)
Vendor Page Anti CCNI2 pAb (ATL-HPA056288) at Atlas Antibodies

Documents & Links for Anti CCNI2 pAb (ATL-HPA056288)
Datasheet Anti CCNI2 pAb (ATL-HPA056288) Datasheet (External Link)
Vendor Page Anti CCNI2 pAb (ATL-HPA056288)