Anti CCNI pAb (ATL-HPA061470)

Atlas Antibodies

SKU:
ATL-HPA061470-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cyclin I
Gene Name: CCNI
Alternative Gene Name: CCNI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063015: 97%, ENSRNOG00000002125: 97%
Entrez Gene ID: 10983
Uniprot ID: Q14094
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLH
Gene Sequence ATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLH
Gene ID - Mouse ENSMUSG00000063015
Gene ID - Rat ENSRNOG00000002125
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCNI pAb (ATL-HPA061470)
Datasheet Anti CCNI pAb (ATL-HPA061470) Datasheet (External Link)
Vendor Page Anti CCNI pAb (ATL-HPA061470) at Atlas Antibodies

Documents & Links for Anti CCNI pAb (ATL-HPA061470)
Datasheet Anti CCNI pAb (ATL-HPA061470) Datasheet (External Link)
Vendor Page Anti CCNI pAb (ATL-HPA061470)