Anti CCNF pAb (ATL-HPA060596)

Atlas Antibodies

Catalog No.:
ATL-HPA060596-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cyclin F
Gene Name: CCNF
Alternative Gene Name: FBX1, FBXO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072082: 78%, ENSRNOG00000007483: 82%
Entrez Gene ID: 899
Uniprot ID: P41002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKREN
Gene Sequence YRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKREN
Gene ID - Mouse ENSMUSG00000072082
Gene ID - Rat ENSRNOG00000007483
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNF pAb (ATL-HPA060596)
Datasheet Anti CCNF pAb (ATL-HPA060596) Datasheet (External Link)
Vendor Page Anti CCNF pAb (ATL-HPA060596) at Atlas Antibodies

Documents & Links for Anti CCNF pAb (ATL-HPA060596)
Datasheet Anti CCNF pAb (ATL-HPA060596) Datasheet (External Link)
Vendor Page Anti CCNF pAb (ATL-HPA060596)