Anti CCND2 pAb (ATL-HPA054196)

Atlas Antibodies

Catalog No.:
ATL-HPA054196-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cyclin D2
Gene Name: CCND2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000184: 94%, ENSRNOG00000057710: 94%
Entrez Gene ID: 894
Uniprot ID: P30279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATW
Gene Sequence VRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATW
Gene ID - Mouse ENSMUSG00000000184
Gene ID - Rat ENSRNOG00000057710
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCND2 pAb (ATL-HPA054196)
Datasheet Anti CCND2 pAb (ATL-HPA054196) Datasheet (External Link)
Vendor Page Anti CCND2 pAb (ATL-HPA054196) at Atlas Antibodies

Documents & Links for Anti CCND2 pAb (ATL-HPA054196)
Datasheet Anti CCND2 pAb (ATL-HPA054196) Datasheet (External Link)
Vendor Page Anti CCND2 pAb (ATL-HPA054196)