Anti CCND2 pAb (ATL-HPA049138)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049138-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CCND2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000184: 70%, ENSRNOG00000057710: 74%
Entrez Gene ID: 894
Uniprot ID: P30279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL |
| Gene Sequence | QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL |
| Gene ID - Mouse | ENSMUSG00000000184 |
| Gene ID - Rat | ENSRNOG00000057710 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCND2 pAb (ATL-HPA049138) | |
| Datasheet | Anti CCND2 pAb (ATL-HPA049138) Datasheet (External Link) |
| Vendor Page | Anti CCND2 pAb (ATL-HPA049138) at Atlas Antibodies |
| Documents & Links for Anti CCND2 pAb (ATL-HPA049138) | |
| Datasheet | Anti CCND2 pAb (ATL-HPA049138) Datasheet (External Link) |
| Vendor Page | Anti CCND2 pAb (ATL-HPA049138) |
| Citations for Anti CCND2 pAb (ATL-HPA049138) – 1 Found |
| Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307. PubMed |