Anti CCNC pAb (ATL-HPA069322)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069322-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CCNC
Alternative Gene Name: CycC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028252: 100%, ENSRNOG00000007719: 100%
Entrez Gene ID: 892
Uniprot ID: P24863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGE |
Gene Sequence | GNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGE |
Gene ID - Mouse | ENSMUSG00000028252 |
Gene ID - Rat | ENSRNOG00000007719 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCNC pAb (ATL-HPA069322) | |
Datasheet | Anti CCNC pAb (ATL-HPA069322) Datasheet (External Link) |
Vendor Page | Anti CCNC pAb (ATL-HPA069322) at Atlas Antibodies |
Documents & Links for Anti CCNC pAb (ATL-HPA069322) | |
Datasheet | Anti CCNC pAb (ATL-HPA069322) Datasheet (External Link) |
Vendor Page | Anti CCNC pAb (ATL-HPA069322) |