Anti CCNC pAb (ATL-HPA069322)

Atlas Antibodies

Catalog No.:
ATL-HPA069322-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cyclin C
Gene Name: CCNC
Alternative Gene Name: CycC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028252: 100%, ENSRNOG00000007719: 100%
Entrez Gene ID: 892
Uniprot ID: P24863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGE
Gene Sequence GNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGE
Gene ID - Mouse ENSMUSG00000028252
Gene ID - Rat ENSRNOG00000007719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNC pAb (ATL-HPA069322)
Datasheet Anti CCNC pAb (ATL-HPA069322) Datasheet (External Link)
Vendor Page Anti CCNC pAb (ATL-HPA069322) at Atlas Antibodies

Documents & Links for Anti CCNC pAb (ATL-HPA069322)
Datasheet Anti CCNC pAb (ATL-HPA069322) Datasheet (External Link)
Vendor Page Anti CCNC pAb (ATL-HPA069322)