Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008873-25

• 
• 
• 

Protein Description: cyclin B2
Gene Name: CCNB2
Alternative Gene Name: HsT17299
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032218: 81%, ENSRNOG00000058539: 27%
Entrez Gene ID: 9133
Uniprot ID: O95067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC
• Gene Sequence: TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC
• Gene ID - Mouse: ENSMUSG00000032218
• Gene ID - Rat: ENSRNOG00000058539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) – 1 Found

Shubbar, Emman; Kovács, Anikó; Hajizadeh, Shahin; Parris, Toshima Z; Nemes, Szilárd; Gunnarsdóttir, Katrin; Einbeigi, Zakaria; Karlsson, Per; Helou, Khalil. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. Bmc Cancer. 2013;13( 23282137):1.