Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008873-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CCNB2
Alternative Gene Name: HsT17299
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032218: 81%, ENSRNOG00000058539: 27%
Entrez Gene ID: 9133
Uniprot ID: O95067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC |
| Gene Sequence | TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC |
| Gene ID - Mouse | ENSMUSG00000032218 |
| Gene ID - Rat | ENSRNOG00000058539 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) | |
| Datasheet | Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) | |
| Datasheet | Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) |
| Citations for Anti CCNB2 pAb (ATL-HPA008873 w/enhanced validation) – 1 Found |
| Shubbar, Emman; Kovács, Anikó; Hajizadeh, Shahin; Parris, Toshima Z; Nemes, Szilárd; Gunnarsdóttir, Katrin; Einbeigi, Zakaria; Karlsson, Per; Helou, Khalil. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. Bmc Cancer. 2013;13( 23282137):1. PubMed |