Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061448-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CCNB1
Alternative Gene Name: CCNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041431: 72%, ENSRNOG00000058539: 68%
Entrez Gene ID: 891
Uniprot ID: P14635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDK |
| Gene Sequence | TRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDK |
| Gene ID - Mouse | ENSMUSG00000041431 |
| Gene ID - Rat | ENSRNOG00000058539 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation) | |
| Datasheet | Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation) | |
| Datasheet | Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation) |
| Citations for Anti CCNB1 pAb (ATL-HPA061448 w/enhanced validation) – 1 Found |
| Loberman-Nachum, Nurit; Sosnovski, Katya; Di Segni, Ayelet; Efroni, Gilat; Braun, Tzipi; BenShoshan, Marina; Anafi, Lait; Avivi, Camila; Barshack, Iris; Shouval, Dror S; Denson, Lee A; Amir, Amnon; Unger, Ron; Weiss, Batia; Haberman, Yael. Defining the Celiac Disease Transcriptome using Clinical Pathology Specimens Reveals Biologic Pathways and Supports Diagnosis. Scientific Reports. 2019;9(1):16163. PubMed |