Anti CCNA2 pAb (ATL-HPA020626 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020626-25

• 
• 

Protein Description: cyclin A2
Gene Name: CCNA2
Alternative Gene Name: CCN1, CCNA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027715: 75%, ENSRNOG00000015423: 75%
Entrez Gene ID: 890
Uniprot ID: P20248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPL
• Gene Sequence: PVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPL
• Gene ID - Mouse: ENSMUSG00000027715
• Gene ID - Rat: ENSRNOG00000015423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCNA2 pAb (ATL-HPA020626 w/enhanced validation) – 1 Found

Silva Cascales, Helena; Burdova, Kamila; Middleton, Anna; Kuzin, Vladislav; Müllers, Erik; Stoy, Henriette; Baranello, Laura; Macurek, Libor; Lindqvist, Arne. Cyclin A2 localises in the cytoplasm at the S/G2 transition to activate PLK1. Life Science Alliance. 2021;4(3)