Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA077614-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cyclin A1
Gene Name: CCNA1
Alternative Gene Name: CT146
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027793: 90%, ENSRNOG00000014052: 90%
Entrez Gene ID: 8900
Uniprot ID: P78396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREK
Gene Sequence CLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREK
Gene ID - Mouse ENSMUSG00000027793
Gene ID - Rat ENSRNOG00000014052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation)
Datasheet Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation)
Datasheet Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation)