Anti CCM2L pAb (ATL-HPA008434)

Atlas Antibodies

Catalog No.:
ATL-HPA008434-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cerebral cavernous malformation 2-like
Gene Name: CCM2L
Alternative Gene Name: C20orf160, dJ310O13.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027474: 96%, ENSRNOG00000009191: 94%
Entrez Gene ID: 140706
Uniprot ID: Q9NUG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDYLEKEVKFLGHLTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLTWRDNEELILRIPTHE
Gene Sequence IRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDYLEKEVKFLGHLTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLTWRDNEELILRIPTHE
Gene ID - Mouse ENSMUSG00000027474
Gene ID - Rat ENSRNOG00000009191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCM2L pAb (ATL-HPA008434)
Datasheet Anti CCM2L pAb (ATL-HPA008434) Datasheet (External Link)
Vendor Page Anti CCM2L pAb (ATL-HPA008434) at Atlas Antibodies

Documents & Links for Anti CCM2L pAb (ATL-HPA008434)
Datasheet Anti CCM2L pAb (ATL-HPA008434) Datasheet (External Link)
Vendor Page Anti CCM2L pAb (ATL-HPA008434)