Anti CCM2L pAb (ATL-HPA008434)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008434-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CCM2L
Alternative Gene Name: C20orf160, dJ310O13.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027474: 96%, ENSRNOG00000009191: 94%
Entrez Gene ID: 140706
Uniprot ID: Q9NUG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDYLEKEVKFLGHLTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLTWRDNEELILRIPTHE |
| Gene Sequence | IRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDYLEKEVKFLGHLTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLTWRDNEELILRIPTHE |
| Gene ID - Mouse | ENSMUSG00000027474 |
| Gene ID - Rat | ENSRNOG00000009191 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCM2L pAb (ATL-HPA008434) | |
| Datasheet | Anti CCM2L pAb (ATL-HPA008434) Datasheet (External Link) |
| Vendor Page | Anti CCM2L pAb (ATL-HPA008434) at Atlas Antibodies |
| Documents & Links for Anti CCM2L pAb (ATL-HPA008434) | |
| Datasheet | Anti CCM2L pAb (ATL-HPA008434) Datasheet (External Link) |
| Vendor Page | Anti CCM2L pAb (ATL-HPA008434) |