Anti CCL28 pAb (ATL-HPA077434)

Atlas Antibodies

Catalog No.: ATL-HPA077434-25

Protein Description: C-C motif chemokine ligand 28
Gene Name: CCL28
Alternative Gene Name: CCK1, MEC, SCYA28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074715: 87%, ENSRNOG00000059640: 94%
Entrez Gene ID: 56477
Uniprot ID: Q9NRJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS
• Gene Sequence: AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS
• Gene ID - Mouse: ENSMUSG00000074715
• Gene ID - Rat: ENSRNOG00000059640
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.