Anti CCL28 pAb (ATL-HPA077434)

Atlas Antibodies

SKU:
ATL-HPA077434-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C-C motif chemokine ligand 28
Gene Name: CCL28
Alternative Gene Name: CCK1, MEC, SCYA28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074715: 87%, ENSRNOG00000059640: 94%
Entrez Gene ID: 56477
Uniprot ID: Q9NRJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS
Gene Sequence AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS
Gene ID - Mouse ENSMUSG00000074715
Gene ID - Rat ENSRNOG00000059640
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCL28 pAb (ATL-HPA077434)
Datasheet Anti CCL28 pAb (ATL-HPA077434) Datasheet (External Link)
Vendor Page Anti CCL28 pAb (ATL-HPA077434) at Atlas Antibodies

Documents & Links for Anti CCL28 pAb (ATL-HPA077434)
Datasheet Anti CCL28 pAb (ATL-HPA077434) Datasheet (External Link)
Vendor Page Anti CCL28 pAb (ATL-HPA077434)