Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA073848-25

• 

Protein Description: C-C motif chemokine ligand 27
Gene Name: CCL27
Alternative Gene Name: ALP, CTACK, CTAK, ESkine, ILC, PESKY, SCYA27, skinkine
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096826: 62%, ENSRNOG00000039530: 62%
Entrez Gene ID: 10850
Uniprot ID: Q9Y4X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR
• Gene Sequence: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR
• Gene ID - Mouse: ENSMUSG00000096826
• Gene ID - Rat: ENSRNOG00000039530
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.