Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA073848-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCL27
Alternative Gene Name: ALP, CTACK, CTAK, ESkine, ILC, PESKY, SCYA27, skinkine
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096826: 62%, ENSRNOG00000039530: 62%
Entrez Gene ID: 10850
Uniprot ID: Q9Y4X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR |
Gene Sequence | CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR |
Gene ID - Mouse | ENSMUSG00000096826 |
Gene ID - Rat | ENSRNOG00000039530 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation) | |
Datasheet | Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation) | |
Datasheet | Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCL27 pAb (ATL-HPA073848 w/enhanced validation) |